Ranibizumab

INN name:	ranibizumab
Lab codes:	RG-3645
Trade name:	Lucentis, rhuFab V2
Chemical name:	Immunoglobulin G1, anti-(human vascular endothelial growth factor) Fab fragment (human-mouse monoclonal rhuFab V2 γ1-chain), disulfide with human-mouse monoclonal rhuFab V2 light chain
Molecular formula:	C2158H3282N562O681S12
Chemical Structure:	Light Chain DIQLTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKVLIYFTSSLHSGVPS RFSGSGSGTDFTLTISSLQPEDFATYYCQQYSTVPWTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Heavy Chain EVQLVESGGGLVQPGGSLRLSCAASGYDFTHYGMNWVRQAPGKGLEWVGWINTYTGEPTY AADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKYPYYYGTSHWYFDVWGQGTLVT VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHL
CAS Registry Number:	347396-82-1
Originator:	Genentech
Developer:	orSight VISION4; Genentech; Manhattan Eye, Ear & Throat Hospital; Novartis Ophthalmics; University of Bonn
Class:	anti-angiogenic ophthalmic agents
Mechanism of Action:	human vascular endothelial growth factor A (VEGF-A) blocker
WHO ATC code:	A10X (Other Drugs Used in Diabetes) S01L-A04 (Ranibizumab)
EPhMRA code:	A10X (Other Drugs Used in Diabetes) S1P (Ocular Antineovascularisation Products)
FDA approval:	Yes
Clinical Trials: Indication Phase Status Age Related Macular Degeneration Phase 4 Completed Branch Retinal Vein Occlusion Phase 4 Recruiting Central Retinal Vein Occlusion Phase 4 Completed Choroidal Neovascularization|Retinal Pigment Epithelial Detachment Phase 4 Completed Degeneration of Macula and Posterior Pole Phase 4 Not yet recruiting Diabetic Macular Edema Phase 4 Completed Diabetic Retinopathy Phase 4 Recruiting Diabetic Retinopathy|Macular Oedema Phase 4 Completed Diabetic Retinopathy|Retinal Neovascularisation Phase 4 Active, not recruiting Efficacy and Safety of Ranibizumab (Lucentis) Phase 4 Not yet recruiting Exudative Age-related Macular Degeneration Phase 4 Completed Macular Degeneration Phase 4 Completed Macular Degeneration|Choroidal Neovascularization Phase 4 Completed Macular Degeneration|Visual Acuity Phase 4 Not yet recruiting Macular Edema Phase 4 Completed Myopic Choroidal Neovascularization Phase 4 Active, not recruiting Neovascular Age Related Macular Degeneration Phase 4 Recruiting Retinal Vein Occlusion Phase 4 Completed Subfoveal Choroidal Neovascularization (CNV) Secondary to Wet Age-related Macular Degeneration (AMD) Phase 4 Recruiting Uveal Melanoma|Radiation Retinopathy|Radiation Maculopathy Phase 4 Active, not recruiting Visual Impairment|Macular Edema Phase 4 Completed Wet Age Related Macular Degeneration Phase 4 Recruiting Choroidal Melanoma Phase 3 Completed Diabetes Mellitus|Macular Edema Phase 3 Completed Macular Edema|Central Retinal Vein Occlusion Phase 3 Active, not recruiting Retinopathy of Prematurity Phase 3 Not yet recruiting Vision Impairment Due to Diabetic Macular Edema Phase 3 Recruiting Eales' Disease Phase 2|Phase 3 Completed Vitreous Hemorrhage|Proliferative Diabetic Retinopathy Phase 2|Phase 3 Completed Diabetic Retinopathy|Retinal Detachment Phase 2 Completed Macular Edema|Branch Retinal Vein Occlusion Phase 2 Completed Persistent Diabetic Macular Edema Phase 2 Withdrawn Pigment Epithelial Detachment Phase 2 Completed Radiation Retinopathy Phase 2 Recruiting Retinal Diseases|Telangiectasis Phase 2 Completed Uveitis Related Cystoid Macular Edema|Steroid-induced Glaucoma - Borderline Phase 2 Recruiting Age-Related Maculopathy Phase 1|Phase 2 Completed Angioid Streaks Phase 1|Phase 2 Withdrawn Clinically Significant Diabetic Macular Edema Phase 1|Phase 2 Completed Coats' Disease|Idiopathic Retinal Telangiectasia|Retinal Angiomatous Proliferation|Polypoidal Choroidal Vasculopathy|Pseudoxanthoma Elasticum|Pathological Myopia|Multi-focal Choroiditis|Rubeosis Iridis|Von Hippel Lindau Disease|BEST VITELLIFORM MACULAR DYSTROPHY, MULTIFOCAL (Disorder) Phase 1|Phase 2 Completed Diabetic Retinopathy|Retinal Diseases|Eye Diseases|Diabetic Angiopathies|Vascular Diseases|Cardiovascular Diseases Phase 1|Phase 2 Completed Glaucoma|New Onset Glaucoma|Neovascular Glaucoma|New Onset Neovascular Glaucoma Phase 1|Phase 2 Withdrawn Ocular Histoplasmosis Syndrome Phase 1|Phase 2 Recruiting PCV|Polypoidal Choroidal Vasculopathy Phase 1|Phase 2 Completed Polypoidal Choroidal Vasculopathy Phase 1|Phase 2 Completed Recalcitrant Wet Age-related Macular Degeneration Phase 1|Phase 2 Recruiting Uveitis|Cytoid Macular Edema Phase 1|Phase 2 Completed Central Serous Chorioretinopathy Phase 1 Completed Conjunctival Neoplasms Phase 1 Completed Corneal Neovascularization Phase 1 Completed Glaucoma, Open-Angle|Failing Bleb Following Trabeculectomy Phase 1 Completed Hereditary Hemorrhagic Telangiectasia (HHT)|Nosebleeds Phase 1 Withdrawn Ischemia|Retinal Vein Occlusion|Pathologic Processes|Retinal Diseases|Eye Diseases Phase 1 Terminated Ischemic Central Retinal Vein Occlusion Phase 1 Completed Macular Telangiectasia Phase 1 Completed Neovascularization Phase 1 Completed Nonarteritic Anterior Ischemic Optic Neuropathy Phase 1 Completed Pterygium Phase 1 Recruiting Radiation Retinopathy|Choroidal Melanoma Phase 1 Completed Retinal Pigment Epithelial Detachment Phase 1 Completed Rubeosis Iridis|Proliferative Diabetic Retinopathy Phase 1 Completed Telangiectasia Phase 1 Completed Venous Retinal Branch Occlusion|Central Retinal Vein Occlusion|Retinal Vein Occlusion|Depression Phase 1 Active, not recruiting Von Hippel-Lindau Syndrome Phase 1 Completed Neurofibromatosis Type 1|Cutaneous Neurofibromas Phase 0 Active, not recruiting Glaucoma Completed Macular Edema Due to BRVO/CRVO Recruiting Macular Edema|Branch Retinal Vein Occlusion|Central Retinal Vein Occlusion Recruiting Macular Edema|Retinal Vein Occlusion Completed Ophthalmology, Macular Degeneration Completed Ophthalmology|Macular Edema|Macular Degeneration Completed Researcher-Subject Relations Active, not recruiting Retinal Pigment Epithelial Detachment With Vascularization|Age Related Macular Degeneration Active, not recruiting Sickle Cell Anemia|Retinopathy Withdrawn Trabeculectomy|Glaucoma Completed
Product Patent Expiry: USA March 2019 South Korea April 2018 Canada April 2018 China April 2018 Japan April 2018 * Patent expiry including patent term extension It is possible to extend the term of a patent in USA, KR and JP. The extension granted at the time of writing this post has been included and marked with *. Please leave a comment below for any update.
Sales of the product (Source: From company report): Years Sales* 2007 393 2008 886 2009 1232 2010 1533 2011 2050 2012 2398 2013 2383 2014 2441 *USD millions
Recent activities on the drug: