Bexagliflozin

INN name:	Bexagliflozin
Lab codes:	EGT-0001442; EGT-1442; THR-1442
Chemical name:	(1S)-1,5-anhydro-1-C-[4-chloro-3-({4-[2-(cyclopropyloxy)ethoxy]phenyl}methyl)phenyl]-D-glucitol
Molecular formula:	C24H29ClO7
Chemical Structure:
CAS Registry Number:	1118567-05-7
Originator:	Theracos
Class:	Antidiabetic
Mechanism of Action:	Sodium-glucose transporter 2 inhibitors
WHO ATC code:	A10X (Other Drugs Used in Diabetes)
EPhMRA code:	A10X (Other Drugs Used in Diabetes)
Clinical Trials: Indication Phase Status Diabetes Mellitus, Type 2 Phase 2 / Phase 3 Recruiting
Product Patent Expiry: For patent data contact us at drugpatentexpiry@gmail.com

Belizatinib

INN name:	Belizatinib
Lab codes:	TSR-011
Chemical name:	4-fluoro-N-(6-{[4-(2-hydroxypropan-2-yl)piperidin-1-yl]methyl}-1-{cis-4-[(propan-2-yl)carbamoyl]cyclohexyl}-1H-benzimidazol-2-yl)benzamide
Molecular formula:	C33H44FN5O3
Chemical Structure:
CAS Registry Number:	1357920-84-3
Originator:	Amgen
Developer:	TESARO
Class:	Antineoplastics
Mechanism of Action:	Anaplastic lymphoma kinase inhibitors; Trosine kinase inhibitor
WHO ATC code:	L01X-E (Protein kinase inhibitors)
EPhMRA code:	L1H (Protein Kinase Inhibitor Antineoplastics)
Clinical Trials: Indication Phase Status Solid Tumors;   Lymphomas Phase 1 / Phase 2 Recruiting
Product Patent Expiry: For patent data contact us at drugpatentexpiry@gmail.com

Canakinumab

INN name:	Canakinumab
Lab codes:	ACZ-885
Trade name:	Ilaris
Chemical name:	Immunoglobulin G1, anti-(human interleukin-1beta (IL-12)) human monoclonal ACZ885; (1Glu>Glp)-gamma heavy chain (221-214')-disulfide with kappa light chain, dimer (227-227'':230-230'')-bisdisulfide
Molecular formula:	C6452 H9958 N1722 O2010 S42
Chemical Structure:	Heavy Chain QVQLVESGGGVVQPGRSLRLSCAASGFTFSVYGMNWVRQAPGKGLEWVAIIWYDGDNQYY ADSVKGRFTISRDNSKNTLYLQMNGLRAEDTAVYYCARDLRTGPFDYWGQGTLVTVSSAS TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPGK Light Chain EIVLTQSPDFQSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSFSGVPS RFSGSGSGTDFTLTINSLEAEDAAAYYCHQSSSLPFTFGPGTKVDIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
CAS Registry Number:	914613-48-2
Originator:	Novartis
Developer:	Novartis
Class:	Anti-inflammatories
Mechanism of Action:	Interleukin 1 beta inhibitors
WHO ATC code:	L04AC08
EPhMRA code:	L4C
FDA approval:	Yes
Clinical Trials: Indication Phase Status Cryopyrin Associated Periodic Syndrome Phase 3 Completed Cryopyrin-associated Periodic Syndromes:|Familial Cold Autoinflammatory Syndrome|Muckle Wells Syndrome|Neonatal Onset Multisystem Inflammatory Disease Phase 3 Completed Hereditary Periodic Fevers Phase 3 Recruiting Systemic Juvenile Idiopathic Arthritis Phase 3 Completed Systemic Juvenile Idiopathic Arthritis Phase 3 Not yet recruiting Systemic Juvenile Idiopathic Arthritis With Active Flare Phase 3 Completed Diabetes Mellitus, Type 2|Atherosclerosis|Prediabetic State Phase 2 Completed Gout Phase 2 Completed NALP3 Mutation Phase 2 Completed Rheumatoid Arthritis Phase 2 Completed TNF-receptor Associated Periodic Syndromes (TRAPS) Phase 2 Completed Type 2 Diabetes Mellitus|Impaired Glucose Tolerance Phase 2 Completed Urticaria|Vasculitis Phase 2 Completed Chronic Obstructive Pulmonary Disease Phase 1|Phase 2 Completed
Product Patent Expiry: USA Sep 2024 (Term may be extended) South Korea Aug 2021 Canada Aug 2021 China Aug 2021 Japan Mar 2024* *** Term of the patents in the above countries may get extended, please contact us for update * Patent expiry including patent term extension It is possible to extend the term of a patent in USA, KR and JP. The extension granted at the time of writing this post has been included and marked with *. Please leave a comment below for any update.
Sales of the product (Source: From company report): Years Sales* 2009 3 2010 26 2011 48 2012 72 2013 119 2014 199 *USD millions

Apalutamide

INN name:	Apalutamide
Lab codes:	ARN-509; JNJ-56021927; JNJ-927
Chemical name:	4-{7-[6-cyano-5-(trifluoromethyl)pyridin-3-yl]-8-oxo-6-thioxo-5,7-diazaspiro[3.4]octan-5-yl}-2-fluoro-N-methylbenzamide
Molecular formula:	C21H15F4N5O2S
Chemical Structure:
CAS Registry Number:	956104-40-8
Originator:	University of California System
Developer:	Janssen Research & Development
Class:	Antiandrogens
Mechanism of Action:	Androgen receptor antagonists; Hormone inhibitors
WHO ATC code:	L02B-B (Anti-androgens)
EPhMRA code:	L2B2 (Cytostatic anti-androgens)
Clinical Trials: Indication Phase Status Prostatic Neoplasms Phase 3 Recruiting Prostate Cancer Phase 1 Recruiting Prostatic Neoplasms|Metastatic Castration-Resistant Prostate Cancer (mCRPC) Phase 1 Recruiting
Product Patent Expiry: For patent data contact us at drugpatentexpiry@gmail.com

Amcasertib

INN name:	Amcasertib
Chemical name:	N-[2-(diethylamino)ethyl]-2,4-dimethyl-5-{[2-oxo-5-(2-phenyl-1,3-thiazol-4-yl)-1,2-dihydro-3H-indol-3-ylidene]methyl}-1H-pyrrole-3-carboxamide
Molecular formula:	C31H33N5O2S
Chemical Structure:
CAS Registry Number:	1129403-56-0
Originator:	Boston Biomedical
Class:	Antineoplastic
WHO ATC code:	L01 (Antineoplastic Agents)
EPhMRA code:	L1 (Antineoplastics)
FDA approval:	Not yet approved
Product Patent Expiry: USA September 2028 South Korea Not entered national phase yet. Canada September 2028* (application under examination) China September 2028 Japan September 2028 * The expiry date is based on the application filing, granted patent expiry may differ from the date mentioned. It is possible to extend the term of a patent in USA, KR and JP. The extension granted at the time of writing this post has been included and marked with **. Please leave a comment below for any update.
Recent activities on the drug: